Protein Info for Psyr_2959 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 105 to 129 (25 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 235 to 259 (25 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 108 (108 residues), 30.4 bits, see alignment E=3.9e-11 PF00528: BPD_transp_1" amino acids 119 to 310 (192 residues), 104.9 bits, see alignment E=4.5e-34

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to psb:Psyr_2959)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS79 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Psyr_2959 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MSRYILSRIAQALLVLWGAYSVTYFILYLLPGDTLSIMLSASGVEIDSLSAQDLAKAKLY
YGLDRGIFEQYVDLLWGAIHGDFGNSLTLNRPVSELLIERLPQTLSLAGLAIVLSLIGGT
GLAYLTAYVRWQPLKVALSRLPSLGFSVPVFWLGLLFIQLFAFTLGWFPATGNQGFSSLI
LPAVTLAIPSAAVYAQVLQRGFQGVWKEPYIITAYAKGLTRAQVQARHAFKNAALPLLTL
IGLQVGNTVSGAVLVETIFARSGVGRLAQEAVLRQDIPVVLAIVAVSAAAFVVVNLIVDL
LYPALDPRIAHTPKVS