Protein Info for Psyr_2904 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details transmembrane" amino acids 144 to 169 (26 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 261 to 286 (26 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 160 to 340 (181 residues), 105.3 bits, see alignment E=1.6e-34

Best Hits

Swiss-Prot: 60% identical to YEJE_ECOLI: Inner membrane ABC transporter permease protein YejE (yejE) from Escherichia coli (strain K12)

KEGG orthology group: K13895, microcin C transport system permease protein (inferred from 100% identity to psb:Psyr_2904)

MetaCyc: 60% identical to putative oligopeptide ABC transporter membrane subunit YejE (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSD4 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Psyr_2904 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MMRSLSPLARRRLERFRSNRRGWWSLWLFCGLFALTLGGELIANDKPLLVSYQHSLYFPV
FKRYTEQQFGGELPFQPDYRSDYVRTLISKGDGWMLFPPIPFSDDTPNYDLTTPAPSPPS
AENWLGTDDQARDVMARVIFGARVSILFALALTFISALIGISAGALQGYYGGWVDLFGQR
LLEVWSGLPVLYLLIILSGFVEPDFWWLLGIMALFSWLTLVDVVRAEFLRGRNLEYVKAA
RALGLGDRKVIMRHILPNAMTATLSYLPFILTGAISTLTALDFLGFGMPAGSASLGELIA
QGKQNLQAPWLGLTAFFALALILTLLVFIGEALRDAFDPRS