Protein Info for Psyr_2891 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid ABC transporter membrane protein, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 43 to 61 (19 residues), see Phobius details amino acids 84 to 108 (25 residues), see Phobius details amino acids 118 to 143 (26 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 269 to 294 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 77 to 193 (117 residues), 54.2 bits, see alignment E=8.3e-19 PF00528: BPD_transp_1" amino acids 99 to 298 (200 residues), 69.1 bits, see alignment E=2.1e-23

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to psb:Psyr_2891)

Predicted SEED Role

"Amino acid ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSE7 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Psyr_2891 amino acid ABC transporter membrane protein, PAAT family (Pseudomonas syringae pv. syringae B728a)
MPIVAKPYDFIDEPSHYPLPQSRVAPPPIKALQVVPARHPGRWIGSIFAALVLLAIVHSL
ATNPRWEWGVFGQWFFSPSVLRGLAQTLLLTLLSTLFSIILGTALALARLSGSPLLAALA
WGYIWFFRSMPALLVLIILYNFAYLYDHIVLGVPFTQLVFAEWSTVDVLSQFTVAVLGLS
LMQSAYTAEIIRGGLIGVDAGQHEAAAALGLPASRRIFRIILPQALRSILPSGFNEIIGL
VKGTSIVYVLALPELFYTVQVIYNRTQAVIPLLIVATVWYLIITTVLTSAQYYVERHFAR
GSARVLPPTPLQRLRGWLHASASGEKHHE