Protein Info for Psyr_2757 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 12 to 218 (207 residues), 234.6 bits, see alignment E=4.6e-74 PF00528: BPD_transp_1" amino acids 29 to 214 (186 residues), 64.1 bits, see alignment E=7.3e-22

Best Hits

Swiss-Prot: 78% identical to MODB_AZOVI: Molybdenum transport system permease protein ModB (modB) from Azotobacter vinelandii

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 100% identity to psb:Psyr_2757)

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSS6 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Psyr_2757 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MPLGSADIAAIWLTLKLASLTTVILLIIGTPVALWLARTDSWLKGPIGAVVALPLVLPPT
VIGFYLLLLLGPNGAVGQLTQSLGLGTLTFSFAGLVIGSVLYSMPFVVQPLQNAFAAIGT
RPLEVAATLRAGPWDTFFHVILPLAKPGFITAAILGFAHTVGEFGVVLMIGGNIPEKTRV
VSVQIFDHVESMEYLQAHWLAGAMLVFSFLVLLALYSSGKSRTGWS