Protein Info for Psyr_2735 in Pseudomonas syringae pv. syringae B728a

Annotation: Helix-turn-helix, Fis-type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 PF06505: XylR_N" amino acids 38 to 137 (100 residues), 122.1 bits, see alignment E=3.2e-39 PF02830: V4R" amino acids 149 to 209 (61 residues), 63.3 bits, see alignment E=8.2e-21 PF00158: Sigma54_activat" amino acids 255 to 421 (167 residues), 233.9 bits, see alignment E=4e-73 PF14532: Sigma54_activ_2" amino acids 256 to 426 (171 residues), 60.9 bits, see alignment E=7.9e-20 PF07728: AAA_5" amino acids 279 to 397 (119 residues), 32.5 bits, see alignment E=3.7e-11 PF25601: AAA_lid_14" amino acids 427 to 498 (72 residues), 70.2 bits, see alignment E=4.9e-23 PF02954: HTH_8" amino acids 545 to 584 (40 residues), 44.8 bits, see alignment 3.8e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2735)

Predicted SEED Role

"sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSU8 at UniProt or InterPro

Protein Sequence (587 amino acids)

>Psyr_2735 Helix-turn-helix, Fis-type (Pseudomonas syringae pv. syringae B728a)
MNNPHCELPDHSVPTEHFSPRGDSSQTHAGDSPTAEELTSCLFFSPDDGRIWLNDQRMML
LHTSSFGTLRREIIERLGLEQARGMFTRAGYLSGARDARLIRERWPQADASSAFRAGTHL
HTLEGMTKVEPLHFKFDAESGFYEGEFLWHHSCEADEHVAAYGIGQDPVCWTEIGYATGF
VSGLFGQMVVFREVECRGMGHANCRVVGKTSEQWGDVERDLSYLRAVNSPAPVHSVPTPA
ASYEASPPTGTDQPLVGASAAFNAATQALQRVAMTPATVLISGESGVGKEMFARQLHQLS
RHREGPFVALNCAAIPDNLIEAELFGVERGAYTGATHSRAGRFERANGGTLFLDEITSLS
LAGQSKLLRALQEREIERVGGVHGIKVNVRVVAATNVDLRKAVAEGDFREDLFYRLNVYP
IALPPLRERRDDIPLLINFFLGRFCQEYGRTPAGLTMRALKTLLGYDFAGNVRELQNLIE
RGLIASDEGQAIDLVHIFRNESLPRDTYSLNHHGALRQASTAGAQQVPATSLLGTLNQPD
KAFSIDELEQRLIQEALDKSEGNLAAASRLLGLSRAQFAYRLKKRQP