Protein Info for Psyr_2733 in Pseudomonas syringae pv. syringae B728a

Annotation: Short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 6 to 122 (117 residues), 54.1 bits, E=2.2e-18
• PF01370: Epimerase
  • amino acids 9 to 85 (77 residues), 28.2 bits, E=1.9e-10
• PF13561: adh_short_C2
  • amino acids 12 to 122 (111 residues), 37.5 bits, E=3e-13
  • amino acids 151 to 250 (100 residues), 60.9 bits, E=2.2e-20

Best Hits

Swiss-Prot: 67% identical to CALA_PSEUH: Coniferyl-alcohol dehydrogenase (calA) from Pseudomonas sp. (strain HR199 / DSM 7063)

KEGG orthology group: K00037, 3-alpha-hydroxysteroid dehydrogenase [EC: 1.1.1.50] (inferred from 100% identity to psb:Psyr_2733)

Predicted SEED Role

"2,3-dihydroxy-2,3-dihydro-phenylpropionate dehydrogenase (EC 1.3.1.-)" in subsystem Cinnamic Acid Degradation or Naphtalene and antracene degradation or Phenylpropanoid compound degradation or Phenylpropionate Degradation (EC 1.3.1.-)

MetaCyc Pathways

• testosterone and androsterone degradation to androstendione (aerobic) (1/3 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation to 2-hydroxypentadienoate (1/5 steps found)
• cinnamate and 3-hydroxycinnamate degradation to 2-hydroxypentadienoate (1/5 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (2/8 steps found)
• superpathway of testosterone and androsterone degradation (7/28 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Androgen and estrogen metabolism
• Bile acid biosynthesis
• Biosynthesis of unsaturated fatty acids
• C21-Steroid hormone metabolism
• Fatty acid biosynthesis
• Fluorene degradation
• Fluorobenzoate degradation
• Isoflavonoid biosynthesis
• Phenylalanine metabolism
• Propanoate metabolism
• Tryptophan metabolism
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.50 or 1.3.1.-

Sequence Analysis Tools

See Q4ZSV0 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Psyr_2733 Short-chain dehydrogenase/reductase SDR (Pseudomonas syringae pv. syringae B728a)
MNLNNKTLIVTGVSSGIGAELARVARFQGARVIGIDRHEPQLTVDSFFQADLADPDNIDA
LIERLPKQIDGLCNIAGVPGTAPVQAVAQVNYLGLRHLTQRLLPRIAPGGSIVNVASILG
SQWPERLELHKALAATESYSEGQEWLAANPVAHETCYQYFKEALIVWSFRQSQEWFRDHS
VRVNCVAPGPVFTPILGDFVSMVGQERVTRDGLHMKRPALADEVAEVIAFLCSDASRWVN
GINLPVDGGLAASYV