Protein Info for Psyr_2733 in Pseudomonas syringae pv. syringae B728a

Annotation: Short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00106: adh_short" amino acids 6 to 122 (117 residues), 54.1 bits, see alignment E=2.2e-18 PF01370: Epimerase" amino acids 9 to 85 (77 residues), 28.2 bits, see alignment E=1.9e-10 PF13561: adh_short_C2" amino acids 12 to 122 (111 residues), 37.5 bits, see alignment E=3e-13 amino acids 151 to 250 (100 residues), 60.9 bits, see alignment E=2.2e-20

Best Hits

Swiss-Prot: 67% identical to CALA_PSEUH: Coniferyl-alcohol dehydrogenase (calA) from Pseudomonas sp. (strain HR199 / DSM 7063)

KEGG orthology group: K00037, 3-alpha-hydroxysteroid dehydrogenase [EC: 1.1.1.50] (inferred from 100% identity to psb:Psyr_2733)

Predicted SEED Role

"2,3-dihydroxy-2,3-dihydro-phenylpropionate dehydrogenase (EC 1.3.1.-)" in subsystem Cinnamic Acid Degradation or Naphtalene and antracene degradation or Phenylpropanoid compound degradation or Phenylpropionate Degradation (EC 1.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.50 or 1.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSV0 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Psyr_2733 Short-chain dehydrogenase/reductase SDR (Pseudomonas syringae pv. syringae B728a)
MNLNNKTLIVTGVSSGIGAELARVARFQGARVIGIDRHEPQLTVDSFFQADLADPDNIDA
LIERLPKQIDGLCNIAGVPGTAPVQAVAQVNYLGLRHLTQRLLPRIAPGGSIVNVASILG
SQWPERLELHKALAATESYSEGQEWLAANPVAHETCYQYFKEALIVWSFRQSQEWFRDHS
VRVNCVAPGPVFTPILGDFVSMVGQERVTRDGLHMKRPALADEVAEVIAFLCSDASRWVN
GINLPVDGGLAASYV