Protein Info for Psyr_2705 in Pseudomonas syringae pv. syringae B728a

Annotation: Helix-turn-helix motif protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF13560: HTH_31" amino acids 25 to 74 (50 residues), 31.7 bits, see alignment E=3.2e-11 PF13443: HTH_26" amino acids 28 to 86 (59 residues), 23.6 bits, see alignment E=9.7e-09 PF01381: HTH_3" amino acids 28 to 81 (54 residues), 45.6 bits, see alignment E=1.2e-15 PF07883: Cupin_2" amino acids 128 to 196 (69 residues), 60.7 bits, see alignment E=1.8e-20

Best Hits

Swiss-Prot: 39% identical to PUUR_SHIFL: HTH-type transcriptional regulator PuuR (puuR) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2705)

Predicted SEED Role

"Putrescine utilization regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSX8 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Psyr_2705 Helix-turn-helix motif protein (Pseudomonas syringae pv. syringae B728a)
MDDPLRRGAASFTGYLSHKATMDTGARLKLVRESYKLSQRELARRSGVTNATISLIEQNR
VSPSISSLKKLLEGIPMTLADFFTFDQPPGQDQYVFRAGDQPDLGRNGARLLLVGATLPS
RQMRFLREQYAPGADSGDEPIVHSEGEECGLVTRGTVELTIDGQVNILGPGDGYYFPTTL
PHRFRNIGHDEAEIISANTPANF