Protein Info for Psyr_2704 in Pseudomonas syringae pv. syringae B728a

Annotation: UDP-galactose 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR01179: UDP-glucose 4-epimerase GalE" amino acids 1 to 334 (334 residues), 430.5 bits, see alignment E=1.7e-133 PF00106: adh_short" amino acids 2 to 112 (111 residues), 45.5 bits, see alignment E=2.9e-15 PF04321: RmlD_sub_bind" amino acids 2 to 161 (160 residues), 50.9 bits, see alignment E=5.7e-17 PF08659: KR" amino acids 2 to 133 (132 residues), 45.1 bits, see alignment E=5.1e-15 PF02719: Polysacc_synt_2" amino acids 2 to 122 (121 residues), 46.5 bits, see alignment E=1.3e-15 PF01370: Epimerase" amino acids 2 to 261 (260 residues), 183.6 bits, see alignment E=2e-57 PF16363: GDP_Man_Dehyd" amino acids 3 to 322 (320 residues), 168 bits, see alignment E=1.9e-52 PF01073: 3Beta_HSD" amino acids 3 to 159 (157 residues), 61.7 bits, see alignment E=2.7e-20 PF07993: NAD_binding_4" amino acids 4 to 165 (162 residues), 29.3 bits, see alignment E=2.2e-10

Best Hits

Swiss-Prot: 55% identical to GALE_PASMU: UDP-glucose 4-epimerase (galE) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to psb:Psyr_2704)

MetaCyc: 55% identical to UDP-glucose 4-epimerase (Bacillus subtilis subtilis 168)
UDP-N-acetylglucosamine 4-epimerase. [EC: 5.1.3.7]; UDP-glucose 4-epimerase. [EC: 5.1.3.7, 5.1.3.2]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSX9 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Psyr_2704 UDP-galactose 4-epimerase (Pseudomonas syringae pv. syringae B728a)
MILVTGGAGYIGAHIALELLEDGRDVVVLDNLCNSSREPLRRIEELCGRQVAFIHGDVRS
KATLHRLFAQYPVKAVVHCAGLKAVGESVREPLRYFETNVSGSVNLCQAMAEAGVFDLLF
SSSATVYGGCEQMPLDENCPLGLPTNPYGHSKLMAEHVMQSVARSDPRWSIGLLRYFNPI
GAHPSGLLGESPCNTPNNLLPFLLQVANRLRPALHIFGSDYPTLDGTGVRDYLHVMDLAE
GHLKALDKIHDERGVSVWNLGTGQGYSVLEVVHAFERISGKAVPLIFEPRRPGDIAACWS
DPGKAARELDWRARFNLDSMLTDAWRWQCMNPQGYRPTALVS