Protein Info for Psyr_2702 in Pseudomonas syringae pv. syringae B728a

Annotation: UDP-galactopyranose mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR00031: UDP-galactopyranose mutase" amino acids 16 to 374 (359 residues), 394.8 bits, see alignment E=1.9e-122 PF13454: NAD_binding_9" amino acids 20 to 94 (75 residues), 22.8 bits, see alignment E=1.2e-08 PF13450: NAD_binding_8" amino acids 20 to 87 (68 residues), 58 bits, see alignment E=1.4e-19 PF03275: GLF" amino acids 161 to 358 (198 residues), 271.9 bits, see alignment E=5.4e-85

Best Hits

Swiss-Prot: 42% identical to GLF1_KLEPN: UDP-galactopyranose mutase (rfbD) from Klebsiella pneumoniae

KEGG orthology group: K01854, UDP-galactopyranose mutase [EC: 5.4.99.9] (inferred from 100% identity to psb:Psyr_2702)

Predicted SEED Role

"UDP-galactopyranose mutase (EC 5.4.99.9)" in subsystem LOS core oligosaccharide biosynthesis or linker unit-arabinogalactan synthesis (EC 5.4.99.9)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.99.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSY1 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Psyr_2702 UDP-galactopyranose mutase (Pseudomonas syringae pv. syringae B728a)
MPRINLESAAREKTPYDFLIVGAGFAGSVLAERLAAGSSKRVLLIDRRPHIAGNAYDHLD
SAGVLVHQYGPHIFHTNAERIVEYLSRFTEWRDYEHRVLASVDKQLLPVPINLDTLNSLY
GLQMNEQEAEAFLASRAEPVETIRTSEDVVISQIGRELYKKFFRGYTRKQWGLDPSQLDR
SVTARVPTRTNSDSRYFTDTFQKMPLHGYTHMFEQILNHPLIDTVLGVDFADVRKAVKYS
HLIYCGPIDEYFGYCYGRLPYRSLRFEHKTVDQAQFQSVAVINYPDEAVPHTRITEYKHL
TGQQHARTSLSYEFPSAEGDPYYPIPRPENAELYKRYKALADQSDEVTFLGRLGTYKYYN
MDQVVGQALALYQRLAHDFPEQPPEPIEQPARG