Protein Info for Psyr_2700 in Pseudomonas syringae pv. syringae B728a

Annotation: PAS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 TIGR00229: PAS domain S-box protein" amino acids 23 to 146 (124 residues), 67.1 bits, see alignment E=7.9e-23 PF13188: PAS_8" amino acids 26 to 80 (55 residues), 28.5 bits, see alignment 4.3e-10 PF00989: PAS" amino acids 26 to 136 (111 residues), 38.7 bits, see alignment E=3.6e-13 PF13426: PAS_9" amino acids 37 to 137 (101 residues), 72.1 bits, see alignment E=1.7e-23 PF08448: PAS_4" amino acids 44 to 140 (97 residues), 24.5 bits, see alignment E=1.1e-08 PF08447: PAS_3" amino acids 47 to 128 (82 residues), 35 bits, see alignment E=5.6e-12 PF02518: HATPase_c" amino acids 267 to 389 (123 residues), 57.5 bits, see alignment E=7e-19 PF00072: Response_reg" amino acids 412 to 523 (112 residues), 61.1 bits, see alignment E=4.3e-20

Best Hits

Swiss-Prot: 100% identical to LOVHK_PSEU2: Blue-light-activated protein (Psyr_2700) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2700)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSY3 at UniProt or InterPro

Protein Sequence (534 amino acids)

>Psyr_2700 PAS (Pseudomonas syringae pv. syringae B728a)
MSENKTRVDNAATGDIKHQGKDIFFAAVETTRMPMIVTDPNRPDNPIIFANRAFLEMTGY
ASEEIIGSNCRFLQGPDTDRTAVQSIRDAIDQRVDISTEILNYRKDGSSFWNALFISPVY
NDAGELIYFFASQLDISRRRDAEEALRQAQKMEALGQLTGGIAHDFNNLLQVMGGYIDLI
GSAAEKPVIDVQRVQRSVHHAKSAVERASTLTKQLLAFARKQKLQGRVLNLNGLVSTTEP
LIERTFGPEVIIETDLDPALKNCRIDPTQAEVALLNIFINARDALIGRLNPKIFIETRNL
VVDELANMSYDGLLPGRYVSIAVTDNGIGMPASIRDRVMDPFFTTKEEGKGSGLGLSMVY
GFAKQSGGAARIYTEEGVGTTLRLYFPVDEAVLSKNDPPKASERRIGSSERILIVEDRPD
VAELAKMVLDDYGYVSEIVLNAREALKRFEAGATYDLLFTDLIMPGGMNGVMLAREVRRR
FPKVKVLLTTGYAESSIERTDIGGSEFEVVSKPCMPQDLARKVRQVLDGPNGIA