Protein Info for Psyr_2699 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 31 to 54 (24 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2699)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSY4 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Psyr_2699 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MIRDDRIAPGAPVYHETHAAGPLLKRISWSAILAGVVLAMVVSLLLNLLGTAIGSASIDP
MQEANPLSGIGTGAGIWVVVSSVISLFVGGWAAGRLAQREGAFHGLLVWASVSLITVYLV
SSAVTGVVRGGLNLAGSGMSALGSGIAQVAPAVGSKIQDQLRAQGIDFNLDDIQGEIETA
MRQTGKPELNPDNVKQEAQATQQDAQNTAKQSAQNPQQADEQLSGLMDRIKAKGDQAWDA
ADRQALVNLIKARGNKTDAEANQIVDQAQASYRQAYAKYQELKAQAEQKAREAAEVTAKR
VSQGAWILLITLVISGLVAAGAGVLGRRTQPPAKVVAAV