Protein Info for Psyr_2696 in Pseudomonas syringae pv. syringae B728a

Annotation: UDP-glucose 6-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 1 to 420 (420 residues), 440.5 bits, E=2.8e-136
• PF03721: UDPG_MGDP_dh_N
  • amino acids 1 to 187 (187 residues), 211.6 bits, E=1.9e-66
• PF00984: UDPG_MGDP_dh
  • amino acids 204 to 296 (93 residues), 118.1 bits, E=3.7e-38
• PF03720: UDPG_MGDP_dh_C
  • amino acids 320 to 423 (104 residues), 104.7 bits, E=8e-34

Best Hits

Swiss-Prot: 38% identical to UDG_RICBR: UDP-glucose 6-dehydrogenase (udg) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 100% identity to psb:Psyr_2696)

Predicted SEED Role

No annotation

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• UDP-α-D-xylose biosynthesis (1/2 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

See Q4ZSY7 at UniProt or InterPro

Protein Sequence (464 amino acids)

>Psyr_2696 UDP-glucose 6-dehydrogenase (Pseudomonas syringae pv. syringae B728a)
MKISVFGSGYVGLVQATVLAEVGHDVVCMDIDQAKIDQLRQGQVHIYEPGLANLVRENLD
QQRLCFTTDEQLAVEHAEVLFIAVGTPSRADGSADLSGFFAVGEAIARHRREPLIIVEKS
TVPVGSGDALRSHIDKALRQAGRLLQFDIVSNPEFLKEGSAVNDCRRPDRIVIGCENEAV
RNVMRELYAPFNRNHERIMFMDLRSAELTKYAANCMLATKISFINQIAELAEHLGADVES
VRLGIGADSRIGYDFIYPGCGYGGSCFGKDIRALIHSAREAHCSNDLLSVVEAINERQKN
KLFERVNAFYQGDLRGKTFALWGLAFKPNTDDMRDAPSRVLMEALWEAGASVRAFDPEAM
QETQRIYGHRKDLMLMGTPESALNEADALIVCTEWQQFKAPDFELIQQRLNAPVIFDGRN
LYDTERLAKRGFHYFPIGRGESCDLPIPQKQWTACNPLVSSQVV