Protein Info for Psyr_2693 in Pseudomonas syringae pv. syringae B728a

Annotation: Glycosyl transferase, family 39

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 164 to 193 (30 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 292 to 309 (18 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details amino acids 377 to 395 (19 residues), see Phobius details amino acids 402 to 422 (21 residues), see Phobius details PF02366: PMT" amino acids 11 to 238 (228 residues), 94.1 bits, see alignment E=1e-30 PF13231: PMT_2" amino acids 63 to 224 (162 residues), 65 bits, see alignment E=9.5e-22

Best Hits

Swiss-Prot: 100% identical to ARNT_PSEU2: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K07264, 4-amino-4-deoxy-L-arabinose transferase [EC: 2.-.-.-] (inferred from 100% identity to psb:Psyr_2693)

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSZ0 at UniProt or InterPro

Protein Sequence (550 amino acids)

>Psyr_2693 Glycosyl transferase, family 39 (Pseudomonas syringae pv. syringae B728a)
MIHVRHRHLALLLLAFVLAYLLPLGFHGLWIPDETRYAQISQEMLYSGNWIAPHFMGLRY
FEKPAAGYWLIALGQQVFGENLFGVRIASALASGLSVLLAYLLAGKIWNDPRKQFASALL
FMSFGFVAGQAGYANLDPQFTFWTNVTLLAFWYAVHSVGRARLAAWALVGVACGIGFMTK
GFLAWALPVIIALPYMLCQRRLAELLRFGPLAVLIAIAVCLPWALAIHQQEPDYWRYFFW
HEHIRRFAGDNAQHAQPWWFYMPLLVAACVPWALLLPATLQQAWQEKNRPDIAFLLLWLL
LPLAFLSLSKGKLPTYILPCLLPLALLMANTLVERLDRGHSTALRANGIFNATVTFLGLV
ALIYLQLEQPVYENEPMHLSLAIIVLFGWTLANALQGLRPLTCWATPALGSWLLIALLPA
ALPNDVINNKTPDPFVVRHQAELAGCTQLLSNDLGAASALAWRLKRPDVALFNTWGELEY
GLGYPDVQGREVRLQDIDAWMKNARSQGRVGVIMRGKSDEELKELESLPRDGQRYDEGNL
AILVYEKSAS