Protein Info for Psyr_2690 in Pseudomonas syringae pv. syringae B728a

Annotation: Glycosyl transferase, family 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 234 to 262 (29 residues), see Phobius details amino acids 270 to 294 (25 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 9 to 155 (147 residues), 52.3 bits, see alignment E=1.1e-17 PF10111: Glyco_tranf_2_2" amino acids 10 to 116 (107 residues), 32.2 bits, see alignment E=1.2e-11 PF00535: Glycos_transf_2" amino acids 10 to 171 (162 residues), 121.8 bits, see alignment E=4.5e-39

Best Hits

Swiss-Prot: 100% identical to ARNC_PSEU2: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K10012, undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase [EC: 2.7.8.30] (inferred from 100% identity to psb:Psyr_2690)

MetaCyc: 66% identical to undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (Escherichia coli K-12 substr. MG1655)
RXN0-3521 [EC: 2.4.2.53]

Predicted SEED Role

"Polymyxin resistance protein ArnC, glycosyl transferase (EC 2.4.-.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.4.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-

Use Curated BLAST to search for 2.4.-.- or 2.4.2.53 or 2.7.8.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSZ3 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Psyr_2690 Glycosyl transferase, family 2 (Pseudomonas syringae pv. syringae B728a)
MKPYPIKFVSIVIPVYNERQSLPELLRRTEAACEQLDHRFEIVLVDDGSRDDSTDILQRA
AERADSPFVAVILNRNYGQHAAIMAGFEQCQGDVVITLDADLQNPPEEIPRLVKLAEQGY
DVVGTVRSNRQDSAWRRWPSKLINLAVQRSTGVAMNDYGCMLRAYRRTIVDAMLACRERS
TFIPILANSFARHTTEVLVDHAEREHGDSKYSPMRLINLMFDLITCMTTTPLRLLSIIGF
SMALLGVLFAALLIVLRLIFGASWAGDGMFVLFAVLFVFTGGQFIGMGLLGEYLGRMYSD
VRARPRFFIEKIVRSSSPVATDSIDSSVTPYMNKVAP