Protein Info for Psyr_2687 in Pseudomonas syringae pv. syringae B728a

Annotation: PepSY-associated TM helix

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 234 to 251 (18 residues), see Phobius details amino acids 363 to 390 (28 residues), see Phobius details amino acids 420 to 449 (30 residues), see Phobius details PF03929: PepSY_TM" amino acids 22 to 393 (372 residues), 230.6 bits, see alignment E=1.9e-72

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2687)

Predicted SEED Role

"Uncharacterized iron-regulated membrane protein; Iron-uptake factor PiuB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSZ6 at UniProt or InterPro

Protein Sequence (464 amino acids)

>Psyr_2687 PepSY-associated TM helix (Pseudomonas syringae pv. syringae B728a)
MSASFSSPEPRPSGAFVAFLKRLHFYIGVFVGPFMLVAALSGVVYALTPQIEDSLYARAL
HTDSRGPAMSLQAQIQRAQASSGPGLSIAAVRPAAREGDTTRVMFSDPGFGPSEHRALFV
DPVSGEIRGDMKVYGTSGVLPLRTWIDQFHRGLLLGDIGRIYSELAASWLWVAALGGLVL
WAVRRRRQIREHGNVRRWHATTGVWLLLGLLFFSATGLTWSQYAGDNIGVLRAYYGWSTP
SVATSLGKSAAMPMSMPMDEHAEHHMHMAPTTQATALDPALFDSVLARARAEHIDAAKVE
IRPSASNDKAWVVSEIDRSWPTQVDAVSINPQTLEVVDHVRFSDYSLPAKLTRWGIDAHM
GVLFGLANQLVLVVFASGLAAMVVMGYVMWWRRRPSLSQARNQQATLLSLWRSLNPGAQW
ALILVALLTGFALPVLGVSLLGFIVLDALLGYRRAARPLVEGKV