Protein Info for Psyr_2686 in Pseudomonas syringae pv. syringae B728a

Annotation: carbamate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 80% identical to ARCC_PSEAE: Carbamate kinase (arcC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00926, carbamate kinase [EC: 2.7.2.2] (inferred from 100% identity to psb:Psyr_2686)

Predicted SEED Role

"Carbamate kinase (EC 2.7.2.2)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or MLST or Polyamine Metabolism (EC 2.7.2.2)

MetaCyc Pathways

L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
L-citrulline degradation (3/3 steps found)
allantoin degradation IV (anaerobic) (2/9 steps found)
guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSZ7 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Psyr_2686 carbamate kinase (Pseudomonas syringae pv. syringae B728a)
MRIVVALGGNALLRRGQPMTADNQRANIRVAAEQIARIYPGNQLVIAHGNGPQVGLLSLQ
AAAYTPVSPYPLDVLGAETEGMIGYMIEQELGNLLDFEVPFATLLTQVEVDPADPAFNNP
GKPVGPVYTQAEAERLAAEKGWAIAPDGDKYRRVVASPRPKRIFEIRPVKWLLEKGCIVI
CAGGGGIPTIYTASGKLTGVEAVIDKDLCSAMLAEELESDLLLIATDVNAAYVDFGKPTQ
KAIGQAHPDEMDKLGFAVGSMGPKVQAACEFARHTGKVAAIGSLSDIEAIVQGHAGTRIS
TGQPGINYR