Protein Info for Psyr_2683 in Pseudomonas syringae pv. syringae B728a

Annotation: arginine:ornithine antiporter, APA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 282 to 311 (30 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details amino acids 398 to 413 (16 residues), see Phobius details amino acids 419 to 439 (21 residues), see Phobius details amino acids 451 to 469 (19 residues), see Phobius details TIGR00905: transporter, basic amino acid/polyamine antiporter (APA) family" amino acids 5 to 475 (471 residues), 644.6 bits, see alignment E=9.6e-198 TIGR03810: arginine-ornithine antiporter" amino acids 7 to 474 (468 residues), 726.6 bits, see alignment E=1.2e-222 PF13520: AA_permease_2" amino acids 12 to 414 (403 residues), 223.9 bits, see alignment E=3.9e-70 PF00324: AA_permease" amino acids 16 to 428 (413 residues), 65.5 bits, see alignment E=3.8e-22

Best Hits

Swiss-Prot: 82% identical to ARCD_PSEAE: Arginine/ornithine antiporter (arcD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03758, arginine:ornithine antiporter (inferred from 100% identity to psb:Psyr_2683)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZT00 at UniProt or InterPro

Protein Sequence (475 amino acids)

>Psyr_2683 arginine:ornithine antiporter, APA family (Pseudomonas syringae pv. syringae B728a)
MSTPPGKLRLGALVALVVGSMIGGGIFSLPQNMAASAEVGAVLVGWAITAIGMLTLAFVF
QTLANRKPDLDGGVYVYAKAGFGDYMGFSSAWGYWISAWLGNVGYFVLLFSTLGYFFPVF
GEGNTVAAVIGASVLLWGVHFLVLRGIQEAAFINLVTTVAKVVPLILFVLIAVFAFKLDI
FTTDIWGLEKPDMGSVMNQVRHMMLVTVWVFIGIEGASIFSARASKRSDVGKATVIGFIT
VLLLLVLVNVLSLGVMTQPELAKLQNPSMAAVLEHIVGPWGAALISVGLIISLLGALLSW
VLLCAEIMFAAAKDHTMPEFLSRENANHVPANALWLTNAMVQVFLVITLFSSSTYLSLIY
LATSMILIPYLWSAAYALRLAIGGEGYENARRERRKDLFIAAVALLYAIWLIYAGGVKYL
LLSALLYAPGVILFAKAKLEAKKPVFTHLENMMFVAVLIGALIAAYGLYDGFLTL