Protein Info for Psyr_2680 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 155 to 172 (18 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details PF12911: OppC_N" amino acids 20 to 66 (47 residues), 45 bits, see alignment 8.4e-16 PF00528: BPD_transp_1" amino acids 108 to 289 (182 residues), 113.7 bits, see alignment E=8.6e-37

Best Hits

Swiss-Prot: 48% identical to APPC_BACSU: Oligopeptide transport system permease protein AppC (appC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to psb:Psyr_2680)

Predicted SEED Role

"Putative glutathione transporter, permease component" in subsystem Utilization of glutathione as a sulphur source

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZT03 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Psyr_2680 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MTAIASLPHSAILPRSRSPFLKKFLANKGAVLGAAVLLLFVLAAVLAPWIAPHDPLKANF
LAVRKAPSLIYWMGTDELGRDLFSRLLYGARSSLLAGGVSVAIAMFIGVPLGLLAGYFGG
KLDMIISQVMEALLSCPFLVLAIALGAFLGPSLTNAMIAIGLSAMPIFARLTRGQVLSIK
HEDYLEGARAIGLPDRWIILRYVLPNVMSPLVVQATLTIASAILAEASLSFLGLGQQPPS
PSWGSMLNTAKNFMEQAPWMSIAPGVAIYITVLCFNLLGDGLRDALDPKG