Protein Info for Psyr_2668 in Pseudomonas syringae pv. syringae B728a

Annotation: Helix-turn-helix, Fis-type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF00239: Resolvase" amino acids 3 to 143 (141 residues), 154.4 bits, see alignment E=1.1e-49

Best Hits

Swiss-Prot: 55% identical to GIN_BPMU: Serine recombinase gin (gin) from Escherichia phage Mu

KEGG orthology group: None (inferred from 100% identity to kpn:KPN_pKPN5p08178)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZT15 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Psyr_2668 Helix-turn-helix, Fis-type (Pseudomonas syringae pv. syringae B728a)
MLIGYARVSKADGSQSLDLQHDALRAAGVERDNIYDDLASGGRDDRPGLTACLKSLRDGD
VLVVWKLDRLGRSLAHLVNTVKELSDRKIGLRVLTGKGAQIDTTTASGRMVFGIFATLAE
FERDLIRERTMAGLASARARGRKGGRKFALTKAQVRLAQAAMAQRDTSVSDLCKELGIER
VTLYRYVGPKGELRDHGKHVLGLT