Protein Info for Psyr_2628 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 184 to 200 (17 residues), see Phobius details PF00005: ABC_tran" amino acids 25 to 172 (148 residues), 82.9 bits, see alignment E=5.4e-27 PF13555: AAA_29" amino acids 28 to 62 (35 residues), 29.2 bits, see alignment 9.7e-11

Best Hits

Swiss-Prot: 40% identical to LOLD_METCA: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: K02003, (no description) (inferred from 100% identity to psb:Psyr_2628)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZT55 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Psyr_2628 ABC transporter (Pseudomonas syringae pv. syringae B728a)
MLQIKGLNVQRGSGVQAHRVQLPELSLTRGQVVAITGESGCGKSTLLEALGLLLAPESVA
HYCLDGMDIAALLKADDQPALADVRARSLGFVLQSGGLLPFLNARDNINLPRRLLGLASK
SDHVERAIAALHLETLLDQFPQALSIGERQRVACVRAIAHQPRLILADEPTAALDPHNAR
QLFELLLGLVAELGLSALIVSHDWQLVNSFGITRLNAVSLPGVTRFETSL