Protein Info for Psyr_2603 in Pseudomonas syringae pv. syringae B728a

Annotation: Secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 13 to 32 (20 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 47 to 380 (334 residues), 143.1 bits, see alignment E=4.8e-46 PF16576: HlyD_D23" amino acids 65 to 280 (216 residues), 48.9 bits, see alignment E=1e-16 PF13533: Biotin_lipoyl_2" amino acids 68 to 111 (44 residues), 29.7 bits, see alignment 8.5e-11 PF13437: HlyD_3" amino acids 193 to 278 (86 residues), 36.2 bits, see alignment E=1.7e-12

Best Hits

KEGG orthology group: K02005, HlyD family secretion protein (inferred from 100% identity to psb:Psyr_2603)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZT80 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Psyr_2603 Secretion protein HlyD (Pseudomonas syringae pv. syringae B728a)
MVGFFRKLNVRKILLRIVLIDLTVSLAGYAFYKGASGEEETAFLSAAAEVTDIEYAVSAQ
GVLQGRNQVDVGAQVSGQLQSLKVKPGDQVKKNQLLAEIDPLPARNALRQAVVKIEQLTA
ERDATLHRLKLAESNDRRYQELGATTAVSKADQDKARFELETQRANLVSLTAQLHTARVQ
EEAARIKLDYTRIFAPMDGQVLAIVTQEGQTVIADQTAPVILKMAQLDTMTVKAQVSEAD
VLKIKPGLAIYFTIPGDPDTRYNATLKAIEPGPVDAASQTGATAESGKAVFYNALFDVLN
LENRFYINMTANVRIVLEAKEGVLTIPVAALGDRRDDGTYSVRVLGEGNEVRTAYVGPGI
NNQVRVEIRSGLKAGDRVVIGERGGVEGV