Protein Info for Psyr_2596 in Pseudomonas syringae pv. syringae B728a

Annotation: PAS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF00989: PAS" amino acids 43 to 136 (94 residues), 32.3 bits, see alignment E=2.1e-11 amino acids 157 to 258 (102 residues), 29.3 bits, see alignment E=1.9e-10 PF08448: PAS_4" amino acids 47 to 149 (103 residues), 32.4 bits, see alignment E=2.4e-11 amino acids 165 to 273 (109 residues), 44.8 bits, see alignment E=3.4e-15 PF13426: PAS_9" amino acids 48 to 139 (92 residues), 31.5 bits, see alignment E=4.5e-11 amino acids 175 to 263 (89 residues), 44 bits, see alignment E=5.6e-15 TIGR00229: PAS domain S-box protein" amino acids 48 to 140 (93 residues), 38 bits, see alignment E=8.1e-14 amino acids 157 to 278 (122 residues), 52.2 bits, see alignment E=3.3e-18 PF08447: PAS_3" amino acids 60 to 140 (81 residues), 25.7 bits, see alignment E=2.8e-09 amino acids 180 to 265 (86 residues), 56.8 bits, see alignment E=5.6e-19 PF00015: MCPsignal" amino acids 292 to 445 (154 residues), 120.6 bits, see alignment E=1.7e-38

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to psb:Psyr_2596)

Predicted SEED Role

"FIG00954558: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZT87 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Psyr_2596 PAS (Pseudomonas syringae pv. syringae B728a)
MTDADCKPKLSRIAAMFNSHLKNTNKALERRLAMLEQAGQILNLETVAVVLDGTGKIQTV
NALFETEMSYAQAELVGRSLSELSPPELSGDVHQKRALTAIRDGKHFSGTLRLVSKTGSR
VWLRTIVVPYKNETGGVEQITLYSSVLTRTIEASRENEALVNALQRSTAVIDFTLDGTVI
SANDNFLRAMGYELNQIKGKHHKMFCVPEESASDAYTQFWERLRRGEFIVDRFRRIDKGG
RDVWLEASYNPITDANGKLYKIAKFATVITEQVEREKAVAEASEMAYQTSIDTDSSAQQG
RKVIKDTLQMLGQLTISMEEATRGIEALDSQSQVIGTIIKTISGIAEQTNLLALNAAIEA
ARAGEQGRGFAVVADEVRQLASRTTKAAEEIVNVVKTNQSLASDAVGVIVRSTEQASEAL
VLANDADRVIQEIQHGANTVVRAVSRFVDQRSS