Protein Info for Psyr_2592 in Pseudomonas syringae pv. syringae B728a

Annotation: transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details transmembrane" amino acids 75 to 93 (19 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 209 to 226 (18 residues), see Phobius details amino acids 250 to 277 (28 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details PF01032: FecCD" amino acids 30 to 339 (310 residues), 281.7 bits, see alignment E=3.3e-88

Best Hits

Swiss-Prot: 70% identical to CBRC_DICD3: Achromobactin transport system permease protein CbrC (cbrC) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to psb:Psyr_2592)

Predicted SEED Role

"Siderophore achromobactin ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZT91 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Psyr_2592 transport system permease protein (Pseudomonas syringae pv. syringae B728a)
MDKHFTVRYRSFSRQFSLTALTRLLSGLALTLLVVLSSLAVGKINLSPATLLSVFTGQAD
ASLVFIVEQLRMPRLALAALVGAALAVSGLILQSIIRNPLASPDLLGITSGASAAAVLYL
SFFSAALGAQFLPLAAISGAGLAALVIYLLAWNQGASPLRMVLIGVGVSALLAAVTTFIL
VFSPLTTTLSAYVWLTGSVYGASWPEPRALAGWLLMTLPLLALLARQVRMQQLDDALAQG
IGVRVQWLRAGLLLVSVALAGLAVAWGGAIAFVGLIAPHIAKRLMPPGFVGQALMAALIG
ANLVMLADLAGRTLFLPLDLPAGIFVAVLGTPFFLYLLINQRH