Protein Info for Psyr_2587 in Pseudomonas syringae pv. syringae B728a

Annotation: IucA/IucC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 619 PF04183: IucA_IucC" amino acids 161 to 408 (248 residues), 270.1 bits, see alignment E=1.8e-84 PF06276: FhuF" amino acids 433 to 604 (172 residues), 135.3 bits, see alignment E=2.9e-43

Best Hits

Swiss-Prot: 43% identical to SBNF_STAA8: 2-[(L-alanin-3-ylcarbamoyl)methyl]-3-(2-aminoethylcarbamoyl)-2-hydroxypropanoate synthase (sbnF) from Staphylococcus aureus (strain NCTC 8325)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2587)

MetaCyc: 50% identical to 2,4-diaminobutanoate--N1-citryl-N3-acyl-N3-hydroxy-1,3-diaminopropane ligase (Acinetobacter baumannii AYE)
6.3.2.-; 6.3.2.-

Predicted SEED Role

"Uncharacterized siderophore S biosynthesis protein, AcsC-like @ Siderophore synthetase superfamily, group C @ Siderophore synthetase component, ligase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZT96 at UniProt or InterPro

Protein Sequence (619 amino acids)

>Psyr_2587 IucA/IucC (Pseudomonas syringae pv. syringae B728a)
MATPLPLQRNAASTTTTAGTGAWLADVSAERYQQVQRRVIGQLLQTLLYEAALPYRCEPL
DDHRHRFAVAVSGGVEYRCEGLLSTSFELIRLDHATLERVDSAGERSVPDLHLALTELLS
PFKDSPHLTRFIQEIEQTQLKDLQARTQGYQPARPAHQLDVDALEQHFMDAHSYHPCYKS
RIGFSLADNRHYGPEFATPFAVVWLAVAKSSASVGHSRSMDFQAFIRQELGTQRWQEIAR
ELAARGKSIDDYQLMPVHPWQWDNVTVSTFYPELASGELIYLGTSTDSYKAQQSIRTLAN
ASQPQRPYVKLAMSMTNTSSTRILARHTVLNGPIITDWLHQLIATDSTAQALNFVILGEV
AGVSFDYRHLPESRSAQTYGTLGAIWRESLHQYLRDDEQAVPFNGLSHVENRYGDGQQTP
FIDAWVNQYGLKEWTRQLLQVTVPPIIHMLYAEGIGMESHGQNIVLIVKQGWPQRIALKD
FHDGVRYSPAHLGRPELCPELVPLPASHAKLNRNSFIITDDVNAVRDFSCDCFFFICLAE
MAIFLRQQYQLDEALFWQMTADVILDYQRAHPQHRDRFGLFDVFAPSYEVEELTKRRLLG
DGERRFRSVPNPLQTYRPQ