Protein Info for Psyr_2585 in Pseudomonas syringae pv. syringae B728a

Annotation: Orn/DAP/Arg decarboxylase 2:Orn/DAP/Arg decarboxylase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01168: Ala_racemase_N
  • amino acids 29 to 230 (202 residues), 29.7 bits, E=7.7e-11
• PF02784: Orn_Arg_deC_N
  • amino acids 32 to 279 (248 residues), 118.2 bits, E=6.2e-38
• PF00278: Orn_DAP_Arg_deC
  • amino acids 224 to 372 (149 residues), 55 bits, E=1.2e-18

Best Hits

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 100% identity to psb:Psyr_2585)

Predicted SEED Role

"Achromobactin biosynthesis protein AcsE, Orn/DAP/Arg decarboxylase family"

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.20

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

See Q4ZT98 at UniProt or InterPro

Protein Sequence (402 amino acids)

>Psyr_2585 Orn/DAP/Arg decarboxylase 2:Orn/DAP/Arg decarboxylase 2 (Pseudomonas syringae pv. syringae B728a)
MHKVPETVLAAIKEARALETDPLAAFFYDLDALQQHVSEVMAALPAGVELYYAIKANSEA
LMLETLAPLVSGFEISSGGEIERVMACPTRKPYVFSGPGKLDSDLRSALLNKVEAIHLES
LNEIARLQQLAEQAGRVQPVFLRINPQLPAAQSSRLAMAGTATPFGIDEADLAEAVRRVD
NASHLTLKGFHVHAMSHQMSVERHEQLLDFYLQRWQEWKALARDPSQLTHFNVGGGIGVD
YLNSQQFDWQRLCRYLEKRLGEQHDAPILRFEPGRFISAYCGYYAIEVLDSKTSHGEHFL
VCRGGTHQFRLPVAQSHDHPVIHLPSTPQPAASSEQAYTIVGQLCTPKDVLSRRQPLKGV
NIGDLLVLPLAGAYGYNISHADFLCHPRPSQHFVRNGERVRQ