Protein Info for Psyr_2573 in Pseudomonas syringae pv. syringae B728a

Annotation: transcriptional regulator, DeoR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF04545: Sigma70_r4" amino acids 31 to 63 (33 residues), 26.7 bits, see alignment 6.6e-10 PF04198: Sugar-bind" amino acids 77 to 329 (253 residues), 245.7 bits, see alignment E=9e-77

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2573)

Predicted SEED Role

"Putative transcriptional regulator of sorbose uptake and utilization genes" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTB0 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Psyr_2573 transcriptional regulator, DeoR family (Pseudomonas syringae pv. syringae B728a)
MPLTPKRKPVHMSDSTQRMASDIDLMTEVAMLYYLENVTQEAIAKRFDLSRAKVSRLLKR
ARDEGIVEVRVLQHPAMNNELELALVERFQLDRALIAVDHSDPDTQRSAVASLVANYLNK
TLGDGMIVAVGMGRNVGAVADNVFLPVTRNCTFVCAIGGSLKAGEYMNPDHICRRLALRF
GGESESLYAPALVANPELRSILISNDTVRSTLDRARRADMALIGIGDMSENSNMVRMGWF
SPQEIAQARLSGTVGDMMGYDFIDIHGQPAVNAIQGRVIGLTVQELFRIPDVVAIASENT
KAAATLGALRSGVINTLATTVTNAHTILALDDATRKN