Protein Info for Psyr_2569 in Pseudomonas syringae pv. syringae B728a

Annotation: monosaccharide ABC transporter substrate-binding protein, CUT2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 32 to 287 (256 residues), 199.8 bits, see alignment E=9e-63 PF00532: Peripla_BP_1" amino acids 56 to 242 (187 residues), 44.8 bits, see alignment E=1.8e-15 PF13377: Peripla_BP_3" amino acids 185 to 295 (111 residues), 32.6 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 100% identity to psb:Psyr_2569)

Predicted SEED Role

"Inositol transport system sugar-binding protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTB4 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Psyr_2569 monosaccharide ABC transporter substrate-binding protein, CUT2 family (Pseudomonas syringae pv. syringae B728a)
MKFGTSLAAVAAFSLLASSISMAADGKTYKIGAAVYGLKGQFMQNWVRELKEHPAVKDGT
VKITVFDGNYDALTQNNQIETMITQHYDAIIFVPIDTKAGVGTVARAMENDIPVIASNTR
VAGNKVPYVGNDDVEGGRLQAQAMVDKLKGKGNVVIIQGPIGQSAQIDREKGELEVLSKH
PDIKIIEKKTANWSRAEAQTLTEDWLNAHQNGGISGIISQNDDMALGALQAVKSRNLKPA
DVPITSIDGMPDAIQAAKKNEITTFLQDAQAQSQGALDVALRTLAGKDYKPQSVIWERYA
KDVKWGDGTDKNYILPWVPVTDANADALYKQVSGGK