Protein Info for Psyr_2566 in Pseudomonas syringae pv. syringae B728a

Annotation: dihydroxyacetone kinase DhaK subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 255 to 274 (20 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details PF02733: Dak1" amino acids 17 to 326 (310 residues), 378.5 bits, see alignment E=1e-117

Best Hits

Swiss-Prot: 43% identical to DHAK2_LISIN: PTS-dependent dihydroxyacetone kinase 2, dihydroxyacetone-binding subunit DhaK (dhaK-2) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: K05878, dihydroxyacetone kinase, N-terminal domain [EC: 2.7.1.-] (inferred from 100% identity to psb:Psyr_2566)

Predicted SEED Role

"Putative dihydroxyacetone kinase (EC 2.7.1.29), dihydroxyacetone binding subunit" in subsystem Dihydroxyacetone kinases (EC 2.7.1.29)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.1.29

Use Curated BLAST to search for 2.7.1.- or 2.7.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTB7 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Psyr_2566 dihydroxyacetone kinase DhaK subunit (Pseudomonas syringae pv. syringae B728a)
MNRVINDPDQVVEDMLRGILVAHPELSQSEGNPRVISKTRPSDQGRVGIVTGGGSGHEPA
FLGYVGPGLVDAVAVGEIFSSPTAKSFFDAFRAADHGAGIACLYGNYAGDNMNVKLAMKM
AASKDLQVRTVVANDDVASAPKSDIAKRRGVAGEIFMWKIGGAAAANGYDLDGVIRVAQK
AVDQCRSIGIGLTPCTIAAVGKPNFQIPDGKMELGIGHHGEPGIEVIDIEPAAAMAERML
EPILADRDFSVDDSVVVLVSGLGATPVMELYVFYAEVERLLKARGLKIHRCYVGNYFTSL
EMMGVTLTLLGLDAELKTLIDHPCRSIGMTQAE