Protein Info for Psyr_2556 in Pseudomonas syringae pv. syringae B728a

Annotation: dCTP deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 2 to 167 (166 residues), 96.7 bits, E=6.6e-32
• PF22769: DCD
  • amino acids 2 to 144 (143 residues), 121.4 bits, E=2e-39

Best Hits

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 100% identity to psb:Psyr_2556)

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.13

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

See Q4ZTC7 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Psyr_2556 dCTP deaminase (Pseudomonas syringae pv. syringae B728a)
MILTGSEIENRVRSGEIVISPFSHENVNPNSYNFRLHDQMKVYEDDVIDVRAEASTRTIE
IGPEGFELQPMKLYLASTIETMGSTHFVPTYAARSSIARLGMFINLSAPLGDIGFVGRWT
LQLYALNRIRVYPGMNIGQMMFWNVKGDIELYSGKYQGATEAFASRIFMDFEKTPRPQPL
VPNLAPFPVVAAQEEVDASPDALAARHGRMATEIPLIAGGRRVQ