Protein Info for Psyr_2555 in Pseudomonas syringae pv. syringae B728a

Annotation: (dCTP deaminase), deoxycytidine triphosphate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF22769: DCD" amino acids 3 to 143 (141 residues), 76.8 bits, see alignment E=1.1e-25

Best Hits

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 99% identity to psp:PSPPH_2711)

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.13

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTC8 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Psyr_2555 (dCTP deaminase), deoxycytidine triphosphate deaminase (Pseudomonas syringae pv. syringae B728a)
MMLTGSEIVKMREVGSVVIEPFDPAHVEVNSYGCHLADLLLEYRSDRIDPHGELEVVEHH
IPPEGFVLYPNRFYLGATAEQIGGIDFASELYANVSTASCGVFIQTSAPLGHTGAAISWT
LEIVVTQPVRVYAGTKVAKVCFWANFGMTTCYAGRYLGSKSTVPSKIILD