Protein Info for Psyr_2545 in Pseudomonas syringae pv. syringae B728a

Annotation: Metallophosphoesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF12850: Metallophos_2" amino acids 1 to 208 (208 residues), 33.5 bits, see alignment E=4.1e-12 PF00149: Metallophos" amino acids 1 to 197 (197 residues), 74.1 bits, see alignment E=2.1e-24

Best Hits

Swiss-Prot: 37% identical to CPDA_ARCNC: 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA (cpdA) from Arcobacter nitrofigilis (strain ATCC 33309 / DSM 7299 / LMG 7604 / NCTC 12251 / CI)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2545)

Predicted SEED Role

"3',5'-cyclic-nucleotide phosphodiesterase (EC 3.1.4.17)" in subsystem cAMP signaling in bacteria (EC 3.1.4.17)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.17

Use Curated BLAST to search for 3.1.4.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTD8 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Psyr_2545 Metallophosphoesterase (Pseudomonas syringae pv. syringae B728a)
MLIAHISDTHVRPRGQLYQGVVDSNAMLAAAVDTINTLDPAPDLILFSGDLVDEGRPEEY
AMARELLQPLRQKLLMIPGNHDHRQNLRDAFAEHDYFINDQDCSFVYSGSAPVRIIGLDI
SVPEQHHGDMTDTAIRWLDSTLALEPDKPTLIMMHQPPFSSGIPYIDAYRCERGERLAEV
VSRYPAIERIVCGHIHRFMQLRFGGTLMCTAPSTTTAIALRLHPEAADASYVEPPALLLH
HWKADTGLITHWVPIGRFEGPFDFA