Protein Info for Psyr_2527 in Pseudomonas syringae pv. syringae B728a

Annotation: GCN5-related N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF13673: Acetyltransf_10" amino acids 22 to 132 (111 residues), 47.4 bits, see alignment E=4.7e-16 PF00583: Acetyltransf_1" amino acids 26 to 125 (100 residues), 65.5 bits, see alignment E=1.3e-21 PF13508: Acetyltransf_7" amino acids 43 to 126 (84 residues), 48.7 bits, see alignment E=2.1e-16 PF08445: FR47" amino acids 68 to 128 (61 residues), 25 bits, see alignment E=3.7e-09 PF11814: DUF3335" amino acids 159 to 361 (203 residues), 291.5 bits, see alignment E=8e-91

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2527)

Predicted SEED Role

"GNAT family acetyltransferase VC2332"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTF6 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Psyr_2527 GCN5-related N-acetyltransferase (Pseudomonas syringae pv. syringae B728a)
MDFIFRDAVETDVDDLLLLENQCFDGDRLTARSFHWMIRRANASLIVAEQAGQLTGYALV
LFHRGTSLGRLYSLAIADAARGKGLGRQLLQRAEQQAVGRDCAYLRLEVRPDNGAAIGLY
ERSGYRRFAQVDDYYQDHAPALRYEKRIVEHARLDSRSVPYYQQTLEFTCGPACLLMAMK
ALQPARSMGRAEELQIWREATTVFMTSGHGGCSPQGLALAALQRGFAVKLLVSVSGPLFL
GGVRSDNKKQVIRLVHEQFCEALQTAGVQTLPNRSLNLPGLLADGGKPLVLISSYRLTRS
KAPHWVMVTDCDSDFVYLHDPDIDHSLHRQAIDCQHMPVSHADFNRMSCFGADKLRAAVI
VFAAPVDDHAGASADRPQDSLP