Protein Info for Psyr_2515 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 187 to 204 (18 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 101 to 268 (168 residues), 95 bits, see alignment E=2.3e-31

Best Hits

Swiss-Prot: 42% identical to SSUC_BACSU: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to psb:Psyr_2515)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTG8 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Psyr_2515 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MTRRDKSLPASAQATVPDKAQRTLWQRYRTPLKGLVVPAVIIVLLEMIVRIGWLPAYQMP
APSEIVLTLRDLADGALWKHISASLLRVLSGFAIGASLALVFAAWVGLSREAEAYLEPTF
AGLRSIPSLAWVPLLLLWLGIGETSKIVLIAIGAFFPVYLNGVAAIRGIDRKLVEVGQMY
GLSRYRLTRRILLPAALPGLFTGLRSGMSLSWMFLVAAELIAATKGLGYLLSDGRETSRP
DIVLAAIIVLATLGKLSDGLLASLEKRFLAWRDTFNGQSREG