Protein Info for Psyr_2475 in Pseudomonas syringae pv. syringae B728a

Annotation: phosphate ABC transporter substrate-binding protein, PhoT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF12727: PBP_like" amino acids 83 to 232 (150 residues), 29.6 bits, see alignment E=7.6e-11 PF12849: PBP_like_2" amino acids 84 to 300 (217 residues), 109.9 bits, see alignment E=3.9e-35 PF13531: SBP_bac_11" amino acids 85 to 310 (226 residues), 29.6 bits, see alignment E=1.2e-10 PF00691: OmpA" amino acids 345 to 440 (96 residues), 70.5 bits, see alignment E=2.7e-23

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to psb:Psyr_2475)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTK8 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Psyr_2475 phosphate ABC transporter substrate-binding protein, PhoT family (Pseudomonas syringae pv. syringae B728a)
MLRALLTALTLSSATLPAFAQAALPLPAGDIPALRIQGSNTINAQLGPALVEGLMRQQGL
QSVQTLPGNTLNEQRVVGTTAAGQPVRVEIAAHGSGTGFTALKAGNADIAASSRPIKDQE
AKDLASLGDLKSAASEQTIAIDGVAVILHPGNPLRQLDTLQLARIFSGEVRNWSEVGGNP
GAIHLYVRDEKSGTYETFKDLVLTKYGKSLLGSAARFESSEQLSDEVSKDINGIGFIGLP
SVRRAKAVAIADGDSRPMLPTISLIATEDYPLSRRLYFYVPTSTPQRWAQALVRFAQSAE
GQAIVAQSGFVAQTVQVLKVQPTAQMPADYQALARKAERLSVNFRFAQGSARLDNKAQQD
LKRVADYLKSSDKLDRHVTLVGFGDAKSDPERAALLSRLRAMAVRRELLKRGVTFRDIVG
LGDEMPVATNEIDDGRIKNRRVEVWVQ