Protein Info for Psyr_2468 in Pseudomonas syringae pv. syringae B728a

Annotation: Enoyl-CoA hydratase/isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 17 to 264 (248 residues), 167.7 bits, E=3.1e-53
• PF16113: ECH_2
  • amino acids 20 to 195 (176 residues), 94.8 bits, E=7.8e-31

Best Hits

KEGG orthology group: K13766, methylglutaconyl-CoA hydratase [EC: 4.2.1.18] (inferred from 100% identity to psb:Psyr_2468)

MetaCyc: 77% identical to 3-methylglutaconyl-CoA hydratase (Pseudomonas putida)
Methylglutaconyl-CoA hydratase. [EC: 4.2.1.18]

Predicted SEED Role

"Methylglutaconyl-CoA hydratase (EC 4.2.1.18)" in subsystem Benzoate transport and degradation cluster or HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism (EC 4.2.1.18)

MetaCyc Pathways

• L-leucine degradation I (5/6 steps found)
• ferrichrome A biosynthesis (1/5 steps found)

KEGG Metabolic Maps

• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.18

Sequence Analysis Tools

See Q4ZTL5 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Psyr_2468 Enoyl-CoA hydratase/isomerase (Pseudomonas syringae pv. syringae B728a)
MTSTSFATIELINDPRGFATLWLNRSDKNNAFNAQMIRELIIALDQVQGDASLRFLLLRG
RGRHFSAGADLAWMQQAADLDYNTNLDDARELAELMYSLARLKIPTLAVVQGAAFGGALG
LISCCDMAIAAADAQFCLSEVRIGLAPAVISPFVVQAIGERAARRYTLTAERFDGQRAQQ
IGLVAECYPAAELQDRTLQWVDNLLLNSPQAMRVSKELLREVGSGVLTPALRRYCESAIA
RIRTSAEGQEGLRAFLQKRTPGWQPVKDQPPGNPVPAASTARHEPQKDSQS