Protein Info for Psyr_2453 in Pseudomonas syringae pv. syringae B728a

Annotation: NUDIX hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF09296: NUDIX-like" amino acids 19 to 107 (89 residues), 48 bits, see alignment E=2.8e-16 PF09297: Zn_ribbon_NUD" amino acids 109 to 140 (32 residues), 38.9 bits, see alignment 8.5e-14 PF00293: NUDIX" amino acids 146 to 260 (115 residues), 78.9 bits, see alignment E=5.4e-26

Best Hits

Swiss-Prot: 100% identical to NUDC_PSEU2: NADH pyrophosphatase (nudC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03426, NAD+ diphosphatase [EC: 3.6.1.22] (inferred from 100% identity to psb:Psyr_2453)

Predicted SEED Role

"NADH pyrophosphatase (EC 3.6.1.22)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTN0 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Psyr_2453 NUDIX hydrolase (Pseudomonas syringae pv. syringae B728a)
MSRPERWTTAVLDVEAPGGLAVVQGDQGFLLDANGVMFPRGWLAGQDLPVQSEHGIGYFE
GEPVYLLVLERSVAVEGCAWQGLRQFMLEGDFAVFQMLGYAAQVSTWAREHRFCGACGRA
TVQIRGERAMFCEHDNLRLYPRISPSMIVLVTRGDEILLARSPRFVTGMYSALAGFVEPG
ESAEDCVHREVMEEVQVRIKNLRYRGSQCWPFPHSMMLGFHAEYESGEIVPQAEEIEDAR
WFHVDDLPPLPANRSIARYLIEAYLAERSGAPEPVLPG