Protein Info for Psyr_2450 in Pseudomonas syringae pv. syringae B728a

Annotation: PAS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 676 PF08447: PAS_3" amino acids 173 to 258 (86 residues), 51 bits, see alignment E=3e-17 TIGR00229: PAS domain S-box protein" amino acids 203 to 272 (70 residues), 23.2 bits, see alignment E=3.2e-09 PF00512: HisKA" amino acids 307 to 372 (66 residues), 36.3 bits, see alignment E=9.4e-13 PF02518: HATPase_c" amino acids 415 to 535 (121 residues), 71.1 bits, see alignment E=2.1e-23 PF00072: Response_reg" amino acids 560 to 670 (111 residues), 67.3 bits, see alignment E=2.7e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2450)

Predicted SEED Role

"Histidine kinase/response regulator hybrid protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTN3 at UniProt or InterPro

Protein Sequence (676 amino acids)

>Psyr_2450 PAS (Pseudomonas syringae pv. syringae B728a)
MSTPGLSSERAIILAPRGRDSQIALRILDEAGYPATVARDVSELVRELGMGAGLAIIADE
ALRNADMTPLLELLGRQPPWSDLPIVLLTHHGGPDHTPPARTGSLLGNVTFLERPFHPVT
LVSLVMTAVRGRRRQYEARARMEDLHESEGRLQNALMAGRLGSWVLEAEDLKLTCSNITK
SHYGRDEQNTLDYDDWLAAVYFEDQPRMQSALQRSLDTGVDLIIEYRNVWPDGSLNWVDV
RARATRSKNGMVGSLAGVTSDITERKQAESQLRRLNETLEQQVEERTSQLRHKEEILRQS
QKMEAVGQLTGGIAHDFNNMLTGIIGSLELIRRRLARGRTEDLNSLIDLGVTSANRAAAL
THRLLAFSRRQSLDSKPVEMNHLVNAMDELLQRSVNESIHLQLRLAHDLWTAEADPNQLE
SALLNLVLNARDAMPDGGTLVVETFNQQLDRSFTNAHENLLPGDYVVLSVSDNGCGMPET
VISRAFDPFFTTKPIGQGTGLGLSMIYGFSKQSHGHVLIKSEVGVGTTVQLFLPRFSGMA
NETEQSFQSNAVYAENGETVLIVEDDPAVRALVSEVLGELGYTFIEAGEATDAVPILESG
RRIDLLISDVGLPGMNGRQLAEIARQLRPELKVLFITGYAEHAAVRGGFLDTGMQLITKP
FAFDHLTSKVREMIEA