Protein Info for Psyr_2437 in Pseudomonas syringae pv. syringae B728a

Annotation: mannitol ABC transporter ATP-binding protein / sorbitol ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 121.1 bits, see alignment E=8.6e-39 PF17912: OB_MalK" amino acids 235 to 288 (54 residues), 35.9 bits, see alignment 1.7e-12 PF08402: TOBE_2" amino acids 281 to 352 (72 residues), 41.3 bits, see alignment E=2e-14

Best Hits

Swiss-Prot: 57% identical to MALK_YERPN: Maltose/maltodextrin import ATP-binding protein MalK (malK) from Yersinia pestis bv. Antiqua (strain Nepal516)

KEGG orthology group: K10230, sorbitol/mannitol transport system ATP-binding protein (inferred from 100% identity to psb:Psyr_2437)

MetaCyc: 80% identical to polyol ABC-type transporterATP-binding component MtlK (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, ATP-binding component" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTP6 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Psyr_2437 mannitol ABC transporter ATP-binding protein / sorbitol ABC transporter ATP-binding protein (Pseudomonas syringae pv. syringae B728a)
MANLSIRNLQKGFDGHQIIKGIDLEVKDREFVVFVGPSGCGKSTLLRLIAGLEEVTSGTI
ELDGRDITQVTPAKRDLAMVFQTYALYPHMTVGKNLSFALDLAGGDKAEIKKKVDEAARI
LELGPLLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQTRLELSRLH
KELQATMIYVTHDQVEAMTLADKVVVLNGGKVEQVGSPLELYHHPANLFVAGFLGTPKMG
FLKGTISRVDSASCEVELDAGTRISLPVNGAGQSVGAAVTLGIRPEHLNLAQGDDCQLQV
VADVSERLGSDTYCHVRTRSGEALTMRIRGDLASQYGETLNLHLDSAQCHLFDAQGLVIA
KALQTAAA