Protein Info for Psyr_2436 in Pseudomonas syringae pv. syringae B728a

Annotation: Mannitol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 PF01232: Mannitol_dh" amino acids 28 to 192 (165 residues), 165.3 bits, see alignment E=1.2e-52 PF08125: Mannitol_dh_C" amino acids 220 to 459 (240 residues), 259 bits, see alignment E=4.6e-81

Best Hits

Swiss-Prot: 48% identical to M2DH_ASPFU: Mannitol 2-dehydrogenase (AFUA_4G14450) from Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2436)

Predicted SEED Role

"Multiple polyol-specific dehydrogenase (EC 1.1.1.-)" in subsystem Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTP7 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Psyr_2436 Mannitol dehydrogenase (Pseudomonas syringae pv. syringae B728a)
MKLNKNNLSRLGADIAVPAYTVESTRQGIAHIGVGGFHRAHQAFYTDALMNSGEGFEWSI
CGVGLRPEDKVVRDALAQQDYLYTLYELGDTPDTKTRIIASISGMLLADDSPQALIDKLA
SPDIRIVSLTITEGGYCIDDSNGQFMAHLPQIQHDLANPDQPTTVFGFLCAALARRRAQG
TPAFTLMSCDNLPHNGAVTRKALLAFATLRDADLHDWIKENVSFPNAMVDRITPMTSAAH
RLQLADEKHIDDAWPVVCEPFVQWVLEDKFVNGRPAWEKVGVQFTDDVTPYEEMKIKLLN
GSHLALTYLGFLKGYRFVHETMNDPLFVSYIRTYMDLDVTPQLASVPGIDLEGYKDTLIE
RFSNQAIADQLERVCSDGSSKFPKFTIPTINRLIVDQGNLERASLVVAAWALYLKGVDEN
GTTYTIPDPRAGFCQALVADDTLITQRLLAVEEIFGSAIPKSAAFVAAFEQNLNDLRTLG
VSGTLEKLLAAKA