Protein Info for Psyr_2411 in Pseudomonas syringae pv. syringae B728a

Annotation: Short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF00106: adh_short" amino acids 44 to 232 (189 residues), 182.7 bits, see alignment E=8.6e-58 PF08659: KR" amino acids 47 to 224 (178 residues), 39.6 bits, see alignment E=8.1e-14 PF13561: adh_short_C2" amino acids 50 to 282 (233 residues), 212 bits, see alignment E=1.4e-66

Best Hits

Swiss-Prot: 53% identical to YHDF_BACSU: Uncharacterized oxidoreductase YhdF (yhdF) from Bacillus subtilis (strain 168)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to psb:Psyr_2411)

MetaCyc: 50% identical to NADP+-dependent aldehyde reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTS2 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Psyr_2411 Short-chain dehydrogenase/reductase SDR (Pseudomonas syringae pv. syringae B728a)
MNEEYPKPPFASQPQEVPGMQGKMDPYPDCGEKSYKGSGRLQGKIALITGADSGIGRAVA
IAFAREGAQVAISYLNEHEDAQETKRWVEEAGRKCLLLPGDLAQKQQCEDIVSKTVAEFG
RIDVLVNNAAFQMTHETLDEISDEEWVKTFDINITAMFRICKAAVPHMPRGGSIINTSSV
NSDMPKPTLLAYATTKGAIANFTGGLAQLLGEKGIRVNSVAPGPIWTPLIPATMTDEDVK
SFGSETPLGRPGQPVEVSPIYVLLASDEASYISGSRYAVTGGKPIL