Protein Info for Psyr_2390 in Pseudomonas syringae pv. syringae B728a

Annotation: xanthine dehydrogenase, molybdenum binding subunit apoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 738 PF01315: Ald_Xan_dh_C" amino acids 20 to 139 (120 residues), 81.2 bits, see alignment E=1e-26 PF02738: MoCoBD_1" amino acids 161 to 385 (225 residues), 192 bits, see alignment E=1.4e-60 PF20256: MoCoBD_2" amino acids 407 to 678 (272 residues), 171.1 bits, see alignment E=5.7e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2390)

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, molybdenum binding subunit YagR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTU3 at UniProt or InterPro

Protein Sequence (738 amino acids)

>Psyr_2390 xanthine dehydrogenase, molybdenum binding subunit apoprotein (Pseudomonas syringae pv. syringae B728a)
MSENIIGVPQRRIDGGKKVSGQARYAADHPMGKMLYAYGVYSTIANGRVLAIKDQQAKAM
PGVVDIFHHDNFPTLHRTPNTKLSFAKMLSASKADEHRLPFEDDRIYYPGQFVALVVAES
FEQARAAAYRVTVDYDERPAVKDLAEGMRVNGARDGGAGHNRGNPDSAFDGAKVKVDQTY
TTPVEVHNPMEMHASTAWWQDGKLFVYESTQGVVNHRNLLANVFDLSPDRVEVRAPFIGS
GFGGKLWPWPHSVAACAAAKVTGRPVQLVLPRAQMFTTVGHRPETRQRLRLATDASGKLV
SIRHESFNNTSMLDDYTENCGGVTKSLYACDNVLVSHKISPINRGTPTSMRAPGAAPGLF
ALESAIDEMALASGMDPLAFRKLNLSDKDQSAGLPWSSNHLPEAIDKAAERFGWQARKAD
VGSMREGDEIIGYGMGACNWEAYQVPTDARVILRSDGTALAQCGLQDIGTGTYTIVAQTV
SQLTGIPMERVEVELGSSAFPAGPVSGGSWVTASVMPAIAGATREALQKLRQYAVSKDAV
FAGQDAEAIKVENGQLVMGEQRASFVDVLNGQRLSRAEGTFQSGMPEAGKYSFRSFGVHF
VEVRWDPGISSLRVSRVVSAIDVGKVVNPLAARNQVEGAIVMGIGMALFEAGEYDPRSGM
PVNNNYAEYVVPVHADQPDIDVLLLDYPDYNLGEFGARGIGEIGVTGLAAAVANAVYHAT
GKRVRSLPISKEKLMAGL