Protein Info for Psyr_2388 in Pseudomonas syringae pv. syringae B728a

Annotation: Twin-arginine translocation pathway signal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF10518: TAT_signal" amino acids 19 to 37 (19 residues), 23.9 bits, see alignment (E = 4.4e-09) TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 20 to 39 (20 residues), 19.1 bits, see alignment (E = 6.3e-08) PF00111: Fer2" amino acids 75 to 122 (48 residues), 31.4 bits, see alignment 2.2e-11 PF01799: Fer2_2" amino acids 142 to 216 (75 residues), 108.4 bits, see alignment E=2.3e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2388)

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTU5 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Psyr_2388 Twin-arginine translocation pathway signal (Pseudomonas syringae pv. syringae B728a)
MTEPKKHKETAGDSSTVQPSRRNFLKFGASGIAAATLSTWIPSDGMLQATPLAPAAPVVE
DSDAPAAGEQRIQLKVNGQVHTLNVPANAVLLDVLRDRLQLTGTKKGCDHGQCGACTLLV
NGVAINSCLSIAVQHQGDSITTIEGLAENGKLHPVQEAFWEHDAYQCGYCTSGQIMSAVA
ILKDPNIASDDASVREAMSGNICRCGAYKNILSAVQSARSKMGGAA