Protein Info for Psyr_2379 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid/polyamine/organocation transporter, APC superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 89 to 114 (26 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 384 to 401 (18 residues), see Phobius details amino acids 408 to 427 (20 residues), see Phobius details PF03845: Spore_permease" amino acids 13 to 271 (259 residues), 30.4 bits, see alignment E=2.8e-11 PF13520: AA_permease_2" amino acids 18 to 400 (383 residues), 154.2 bits, see alignment E=8.1e-49 PF00324: AA_permease" amino acids 19 to 397 (379 residues), 100 bits, see alignment E=2e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2379)

Predicted SEED Role

"Amino acid transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTV4 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Psyr_2379 amino acid/polyamine/organocation transporter, APC superfamily (Pseudomonas syringae pv. syringae B728a)
MATAETSSLRRAITAPMLTLFILGDVLGAGVYALAGTIAGRVGGAIWAPLLIALCFALLT
AASYAELVTKYPRAGGAAVYAEKAFGKPLLSFLVGFSMVAAGVTSAAGLAVAFAGDYFQA
LLDWPAQWVCVAFLVTVGLLNARGIKESLSANLVMTVIELSGLLMVIAAAIWFVSQGQGV
PQRVFELDSASPATAILGASLLAFYSFVGFETSANLAEEIKDVRKVYPRALFGALLAAGA
VYILVGMGAAMVLPVEQLKDSQAPLMDVVSASGLGIPAPWFAVIALIAVANGALLTMIMA
SRLTFGMAREGLLPAVMGSVLPKRRTPGLAILATTLVAIALSFTSTLTILAETVVLLLLF
VFLSVNIAVLVLKRDKVEAGHFQVHWVIPLLGILSCLLLLTQQGPETWLRAGIMLAVGAA
LYGLTRLGSSALASHPR