Protein Info for Psyr_2373 in Pseudomonas syringae pv. syringae B728a

Annotation: L-arabinose ABC transporter membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 31 to 48 (18 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 307 to 324 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 63 to 321 (259 residues), 124.6 bits, see alignment E=2.1e-40

Best Hits

Swiss-Prot: 63% identical to ARAH_ECOLI: L-arabinose transport system permease protein AraH (araH) from Escherichia coli (strain K12)

KEGG orthology group: K10538, L-arabinose transport system permease protein (inferred from 100% identity to psb:Psyr_2373)

MetaCyc: 63% identical to arabinose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

"L-arabinose transport system permease protein (TC 3.A.1.2.2)" in subsystem L-Arabinose utilization (TC 3.A.1.2.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTW0 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Psyr_2373 L-arabinose ABC transporter membrane protein (Pseudomonas syringae pv. syringae B728a)
MNNKKEVRMSTESSLQAPRQGMNLRRFADDWVMLLAAVGIFLLCAVFIDNFMSPLNMRGL
GLAISTVGIAACTMLFCLASGHFDLSVGSVLACSGVIASIVIRDTDSVFLGVSAALALGL
VVGLINGIVIAKLRINALITTLATMQIVRGLAYIFSNGKAVGVSNEDFFIFGNGQVYGVP
VPILITIACFIFFGWLLNYTTYGRNTMAIGGNQEAALLAGVHVDRTKIIIFAVHGLVGAL
AGVVLASRMTSGQPMIGQGFELTIISACVLGGVSLSGGIGMIRHVIAGVLILAIIENAMN
LKNIDTFYQYVIRGTILLLAVIIDRMKRR