Protein Info for Psyr_2360 in Pseudomonas syringae pv. syringae B728a

Annotation: CBS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF00571: CBS" amino acids 11 to 63 (53 residues), 47.4 bits, see alignment E=1e-16 amino acids 75 to 127 (53 residues), 48.6 bits, see alignment E=4.2e-17

Best Hits

Swiss-Prot: 33% identical to YHCV_BACSU: CBS domain-containing protein YhcV (yhcV) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2360)

Predicted SEED Role

"CBS domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTX3 at UniProt or InterPro

Protein Sequence (146 amino acids)

>Psyr_2360 CBS (Pseudomonas syringae pv. syringae B728a)
MKTVAQLLKLKDLQNQQVHTIGPDQMVLDALKLMAEKNIGALPVVEGNVVVGVISERDYA
RKVVLKGRSSVGTPVRDIMSSKVITVDSQRSVEACMGIMTDSHLRHLPVVEGGQLLGLLS
IGDLVKEAIAEQANLIQQLEQYIRGE