Protein Info for Psyr_2351 in Pseudomonas syringae pv. syringae B728a

Annotation: tRNA synthetase, class-II (G, H, P and S)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF13393: tRNA-synt_His" amino acids 14 to 132 (119 residues), 30.2 bits, see alignment E=1.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2351)

Predicted SEED Role

"Histidyl-tRNA synthetase-related domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTY2 at UniProt or InterPro

Protein Sequence (193 amino acids)

>Psyr_2351 tRNA synthetase, class-II (G, H, P and S) (Pseudomonas syringae pv. syringae B728a)
MTQKTVSGAIFIEAGAEEAIVPALWGQDTFIEKAGGSEIIGQMWAFEDKAGRACCLIPEA
TALFQERSEALLEGRRDAMFFYVARCYRYERPQAGRYREFTQLGLEILSPSPQQALLRSQ
AICTGFLDSLGLDYELNTAVKRGLSYYLEGNGFEVRCSRLGAQQQVVGGGAYREGAGFGI
GLERLVLALGCGQ