Protein Info for Psyr_2335 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF00005: ABC_tran" amino acids 23 to 161 (139 residues), 120.3 bits, see alignment E=9.4e-39 PF08402: TOBE_2" amino acids 263 to 335 (73 residues), 52.4 bits, see alignment E=4.7e-18

Best Hits

Swiss-Prot: 44% identical to POTG_ECOLI: Putrescine transport ATP-binding protein PotG (potG) from Escherichia coli (strain K12)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 100% identity to psb:Psyr_2335)

MetaCyc: 44% identical to putrescine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTZ7 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Psyr_2335 ABC transporter (Pseudomonas syringae pv. syringae B728a)
MAFLQLEGLSKRYGSIDAVVATNLAVDKGEFVSLLGPSGCGKTTTLQMIAGFVEVSDGRI
VLDGRDITHAKPSSRGLGVVFQSYALFPHMTVADNVAFGLRMRKVAAAELHPRVKRVLEL
VRLGQHAERYPRELSGGQRQRVALARALVIEPPVLLLDEPLSNLDANLREEMQFEIRRIQ
NEVGITTLMVTHDQAEALSISDRVVVMQAGRITQIDEPYKLYEHPRTRFISGFVGKANML
QGDLDSSGIPQIRQVPGDGSLTLSLRPEKIDLVAPGCGRLSGRIVTRYFLGSQWLYRIET
GIGEVTVVRRNDGQAPLEQGAAVDMDWPDELLRVLDADEVRA