Protein Info for Psyr_2333 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 79 to 252 (174 residues), 50.8 bits, see alignment E=9e-18

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to psb:Psyr_2333)

Predicted SEED Role

"ABC-type spermidine/putrescine transport system, permease component II"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTZ9 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Psyr_2333 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MSKNGPLALSFHALVVIFMMAPLVVVCLVAFTPENTLSLPTTHFSLRWFKAVFERADFID
SFYNSLILAFVSATLATLIAVPAALAITRHTFPGRNFFNALFLSPIIIPHLVLGVAMLRL
FALMGVNGSFTWLIFAHVLVITPYVLRLVLAAAIGIDRSAEHAAESLGADRFTLFRQITL
PMILPGVAGGWLLAFINSFDEVTLSIFVTSPATQTLPVRMYVYATESIDPMMAAVSALVI
ALTAATMILLDRVYGLDRVLVGKH