Protein Info for Psyr_2331 in Pseudomonas syringae pv. syringae B728a

Annotation: FAD-dependent pyridine nucleotide-disulfide oxidoreductase:BFD-like [2Fe-2S]-binding region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 6 to 316 (311 residues), 90.8 bits, see alignment E=2.2e-29 PF13450: NAD_binding_8" amino acids 8 to 50 (43 residues), 22.7 bits, see alignment 2e-08 PF04324: Fer2_BFD" amino acids 372 to 424 (53 residues), 37.2 bits, see alignment 6.2e-13 PF17806: SO_alpha_A3" amino acids 373 to 449 (77 residues), 41 bits, see alignment E=4e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2331)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU01 at UniProt or InterPro

Protein Sequence (463 amino acids)

>Psyr_2331 FAD-dependent pyridine nucleotide-disulfide oxidoreductase:BFD-like [2Fe-2S]-binding region (Pseudomonas syringae pv. syringae B728a)
MSDQAIAIVGAGPAGIRAAQTLLAHGIKACLIDEGLRGGGQVYRRQPDNFQRSAKALYGF
ESAKAVAVHNALDTLAAQIDYRPQTLVWNAEDHQLDTLQNGTAATLDFSHLIVATGATDR
ILPVPGWTLPGVYSLGAAQIALKYQGCAIGQRVVFCGTGPLLYLVAYQYAKAGAKVLAVL
DSAPFSAQCKALPALLGQPATLAKGMYYRAWLSAHGIPVHQGAQLTRIDGEKRVGGIEWQ
RNGKTGHLACDAVAFAHALRSETQLADLLGCEFAWSALNRAWLPTRDDCGRSSVSGIYLA
GDGAGIMGADAAEMAGELAALGLLQDIGVVADTARIDTLKTALRRIERFRHGLETAFPFP
EDWAAKVADDTLVCRCEEVSAGEIRSAVQDGHWEINRVKAMCRVGMGRCQGRMCGLAAAE
IIARESGRPVEHVGRLRGQAPIKPLPFGLGMQPMEKQSVETQP