Protein Info for Psyr_2328 in Pseudomonas syringae pv. syringae B728a

Annotation: sodium/proton antiporter, CPA1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 61 to 80 (20 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 195 to 220 (26 residues), see Phobius details amino acids 234 to 264 (31 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 351 to 370 (20 residues), see Phobius details amino acids 382 to 405 (24 residues), see Phobius details amino acids 411 to 432 (22 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 14 to 272 (259 residues), 79.1 bits, see alignment E=1.6e-26 amino acids 328 to 437 (110 residues), 31.9 bits, see alignment E=3.5e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2328)

Predicted SEED Role

"sodium/hydrogen exchanger family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU04 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Psyr_2328 sodium/proton antiporter, CPA1 family (Pseudomonas syringae pv. syringae B728a)
MSFIVCMGVLGVLLMLLALTSSYLRWMPVTTSAVCLGFGFGIGPMGLDIVDLDFEKSYEW
LERLTEVAVLFSLFGTGIKLRLPLRGKAWHSAYWLAGPVMLATIAGVTVAGHYIIGLDWG
VSLLLGAMLSPTDPVLAGMVQVNNAQDQDRLRFGLSGEAGLNDGTAFPFVIFALLYLSSG
GAMSDWVQGWLIKDLIWAVPAGLLIGYGMGRGVGHLMIFLRIKNADSTTSPNDFLALALI
ALAYVVAQSVGAFGFLSVFAAGFGLRQAEVRVTRSELPSEHVAQPVLGHMTSSLEQGTVA
QVDDMSDSQLAAGVMMGDMLAFGSLVERAMEVLLITLLGAALAMYWDWRAIGLGIALFCV
IRPASVWLLVSRRLLNVRQKALVGWFGIRGIGSLYYLCFALSHGLAHDVGHVVIGMTLSV
VALSILVHGISIQPLLERYERSAAASPD